PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00341g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family CPP
Protein Properties Length: 975aa    MW: 105343 Da    PI: 7.3909
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00341g00027.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73e-15554592341
                       TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                               +k+CnCkk+kClk+YC+Cfaag +C+ +C+C++C N+ e
  Peaxi162Scf00341g00027.1 554 CKRCNCKKTKCLKLYCDCFAAGIYCAGSCTCQGCLNRPE 592
                               79**********************************876 PP

2TCR47.14.7e-15641678138
                       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkN 38 
                               ++k+gCnCkks C+kkYCeC++a++ Cs+ C+Ce+CkN
  Peaxi162Scf00341g00027.1 641 RHKRGCNCKKSMCQKKYCECYQANVGCSNGCRCEGCKN 678
                               589**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.6E-13552593IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.387553681IPR005172CRC domain
PfamPF036383.3E-11555590IPR005172CRC domain
SMARTSM011143.1E-14641682IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.9E-10643678IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 975 aa     Download sequence    Send to blast
MVHAGCSKVY EVFPPSMCFS YFCLFWSQDS PVFTYISNLS PIQPVKGATV VQGFPGLNSP  60
PLVFTSPRFN VHSRSSFLKR SHFPQLSSEA FSGKNDDYND TTTDSDGTGL SVSQLRSEQS  120
PSVQKVSDNN ISVHKQSGSL VRCADEFLVD VSNSESGNPS NLTNPSPKEA DNIPQSPNTA  180
AESKESVANL GNKDDARKDK IQNDAAFAVV EKAEEDNKGK CSSDQKFIGF NSSNIDSDFS  240
SPDLCAKIEP NLPADSSLHH HYGDHCMAQL SRADHPMLDE TSIQTKPLET AHDCRDNIDK  300
INTASSADES NVQHDSQTKA GQHQSGIRRR CLQFEDAQQK IAPTSSCSQN ASGTVGFPGP  360
PVSPAFSEVV ESVSSNRSST ASNSLLTQLE SSSDNSGSFA VKVPKPSGIG LHLNSILNAM  420
HAGSGATVSV KSAERGNLSI RGKKLASMMS CHPSENIKKC LISNVVGGNM TSDDGKLESD  480
ASNADNFAAS LSLSNAKHLS DTALLRPTEH TSSHKRKSNS GYIDSSMNYN QSSPKKKRQA  540
CLKKPPDAND VDGCKRCNCK KTKCLKLYCD CFAAGIYCAG SCTCQGCLNR PEYEDTVLDV  600
RQQIQSRNPL AFVSKIVQRP TDLPSNILQE DGASFTPSSA RHKRGCNCKK SMCQKKYCEC  660
YQANVGCSNG CRCEGCKNIY GVKEEYGKEL VNKHCITERL ERSVGEKVEM VTATSGLLQS  720
DPSNRCNLTP LTPSFHCSDR GKNASNSWFT PGKYLSLPES GQAITAAYGL SPGSPRSSTN  780
HDINQQTACD ILDLVTFDPD FNISNAKLAN EFSPVFHVPS NMVDLSALSK SQDWASNSGG  840
QLFPRTVQSQ PTRPSCWRNS PMTPMTQFDG SGMNALESLD SDKKSNVIED DTPEILKDSS  900
VPLRGVKVSS PNKKRVSPPH CHLNEVGSSS SGRGLTSRKF ILQAVPLFPP LTPCIGSKDV  960
AAHNTDNCQK DSSSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016537847.10.0PREDICTED: uncharacterized protein LOC107839029
TrEMBLK4CLU10.0K4CLU1_SOLLC; Uncharacterized protein
STRINGSolyc08g067150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-54TESMIN/TSO1-like CXC 2